PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00279_0100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 587aa    MW: 62201.4 Da    PI: 9.4886
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00279_0100genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.43.9e-141966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd  l+ +v+++  g+W+tIa + g+ R++k+c++rw k+l
    kfl00279_0100 19 KGLWTQEEDNTLALCVQRFKEGNWSTIAMKCGLQRSGKSCRLRWVKHL 66
                     678*****************************************9986 PP

2Myb_DNA-binding41.82.5e-1373117248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g+ T+eE+ + +++ k +G++ W+ Ia+ ++ gR+++ +k++w++++
    kfl00279_0100  73 GPLTEEEQRKVIELQKVHGNK-WSHIAQFLP-GRSDNTIKNFWNSHR 117
                      678******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.5271466IPR017930Myb domain
SuperFamilySSF466897.86E-2816113IPR009057Homeodomain-like
SMARTSM007171.5E-101868IPR001005SANT/Myb domain
PfamPF002492.4E-121966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-192073IPR009057Homeodomain-like
CDDcd001678.54E-92266No hitNo description
PROSITE profilePS5129422.56167121IPR017930Myb domain
SMARTSM007173.5E-1271119IPR001005SANT/Myb domain
PfamPF002495.4E-1273117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-1974119IPR009057Homeodomain-like
CDDcd001673.93E-1076116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0032880Biological Processregulation of protein localization
GO:0048629Biological Processtrichome patterning
GO:2000039Biological Processregulation of trichome morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MSEDSEDGSK DRKGQDFKKG LWTQEEDNTL ALCVQRFKEG NWSTIAMKCG LQRSGKSCRL  60
RWVKHLSPHV RSGPLTEEEQ RKVIELQKVH GNKWSHIAQF LPGRSDNTIK NFWNSHRKRL  120
ARRAAREAAA RAKAQGLAYD VAMLPGYEGY DSEGTLRDSS HMGGSQLGST EEEGESEGDT  180
GQYGSSYLDA LPGGPYEEAS SSASSGDTQR MRMAGAHGHA PRMPHQMYHM GGTKSPGMPP  240
HGMAPGGWQQ GPGLGGSRLG QMRGGGGPLP QHQQMHMRQL RPSRLSIAGA TDGGAAGGPL  300
MGPSQLQRKN GHAPLAGGAR GHPGQAGHPQ ALLAPQHPGA PRQLTPAGGP PSFSKMMQDA  360
SLYGLPSSGS GSGLVPWVGG FAGFEPGWPS PHMPKLESME EGMQSNTVSP LGGAGPPNPF  420
QYLTSPTSLA HHFATKPIGG FSQFPNPAPS PRFDGSGSAF SPRFDASPRY GSGFKFDLSP  480
RFDMSPRFEA SPTGTFESNK LSPADHFAGA SSVPAKKPAT SYSPSPAPFM SLPRSLSLPP  540
DPAYGRFHGL ESPTLASLLV SPKCEGGAFG GLFNDSPDNE GPPASRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26161194106B-MYB
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27920.13e-35myb domain protein 0